PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00050744001
Common NameGSBRNA2T00050744001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 451aa    MW: 49245.5 Da    PI: 7.4993
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00050744001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.71.1e-27181234256
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          ++++WtpeLH+rFveave+L G ekA+P++ilelm+v++Lt+++v+SHLQkYR++
  GSBRNA2T00050744001 181 KKVDWTPELHRRFVEAVEKL-GLEKAVPSRILELMGVHCLTRHNVASHLQKYRSH 234
                          689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.284177236IPR017930Myb domain
SuperFamilySSF466896.45E-18180237IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-26181234IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.607.1E-26181237IPR009057Homeodomain-like
PfamPF002495.3E-8183232IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MLALSPERNS TRDDGESEFL ATSCGFSINP EEDFPEFAIH GDLLDIIDFD DLFGVAGDVL  60
PDLEMDPEIL GGDLSVHVNA SSTITTTTSS SEKTESQGKA NNKKGISGKG EEVVSKRDHN  120
ETPLAETVVN YDGDSGRKRK HSSTGSTKSN PISNNEGKRK VKLYTVVYIL TGPNGLIFIR  180
KKVDWTPELH RRFVEAVEKL GLEKAVPSRI LELMGVHCLT RHNVASHLQK YRSHRKHLVA  240
REAEAANWTR KRHIYGLDST GANANGRNRN GWLAPAPTLG YPPPPPAAVA SPSVHHHHFR  300
PLHVWGHPTV DQSVMPHVWP KHLSPPSTAM ATPPFWVSDT PYWPRSHNGT TPYLPTVATR  360
FTTPPVAGIP QALPSHHMVY NYKPDHGFGG PRSLVDLHPS KESVDAAIGD VLTRPWLPLP  420
LGLKPPAVDG VITELHRHGI SDVPPAASCA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-14180232557ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.240502e-79vegetative meristem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00050744001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013652679.10.0PREDICTED: transcription activator GLK1-like isoform X1
SwissprotQ9SIV30.0GLK1_ARATH; Transcription activator GLK1
TrEMBLA0A078H3G40.0A0A078H3G4_BRANA; BnaA07g00410D protein
STRINGBra036482.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22092773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.20.0GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]